PI16 Antibody - middle region : Biotin

PI16 Antibody - middle region : Biotin
SKU
AVIARP55590_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI16

Key Reference: Reeves,J.R., Clin. Cancer Res. 12 (20 PT 1), 6018-6022 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidase inhibitor 16

Protein Size: 463

Purification: Affinity Purified
More Information
SKU AVIARP55590_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55590_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221476
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×