PI4K2B Antibody - middle region : HRP

PI4K2B Antibody - middle region : HRP
SKU
AVIARP57204_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules. PIP itself may also have direct functional and s

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI4K2B

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatidylinositol 4-kinase type 2-beta

Protein Size: 481

Purification: Affinity Purified
More Information
SKU AVIARP57204_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57204_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55300
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×