PIK3R4 Antibody - N-terminal region : Biotin

PIK3R4 Antibody - N-terminal region : Biotin
SKU
AVIARP55087_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein can regulate subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R4

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 153kDa

Peptide Sequence: Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 4

Protein Size: 1358

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP55087_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55087_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 30849
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×