PIK3R4 Antibody - N-terminal region : HRP

PIK3R4 Antibody - N-terminal region : HRP
SKU
AVIARP55087_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein can regulate subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R4

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 153kDa

Peptide Sequence: Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 4

Protein Size: 1358

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP55087_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55087_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 30849
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×