PIM1 Antibody - N-terminal region : Biotin

PIM1 Antibody - N-terminal region : Biotin
SKU
AVIARP56390_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B, resulting in enhanced nuclear export and

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1

Key Reference: Wernig,G., (2008) Blood 111 (7), 3751-3759

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase pim-1

Protein Size: 404

Purification: Affinity Purified
More Information
SKU AVIARP56390_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56390_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5292
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×