PIWIL2 Antibody : HRP

PIWIL2 Antibody : HRP
SKU
AVIARP57108_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2

Key Reference: Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Piwi-like protein 2

Protein Size: 973

Purification: Affinity Purified
More Information
SKU AVIARP57108_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57108_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55124
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×