PLCB1 Antibody - middle region : HRP

PLCB1 Antibody - middle region : HRP
SKU
AVIARP55844_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLCB1

Key Reference: Fantuzzi,L., (2008) Blood 111 (7), 3355-3363

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Protein Size: 1173

Purification: Affinity Purified
More Information
SKU AVIARP55844_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55844_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23236
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×