PLCD1 Antibody - N-terminal region : FITC

PLCD1 Antibody - N-terminal region : FITC
SKU
AVIARP56689_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLCD1

Key Reference: Fu,L., (2007) Cancer Res. 67 (22), 10720-10726

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Protein Size: 756

Purification: Affinity Purified
More Information
SKU AVIARP56689_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56689_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5333
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×