PLDN Antibody - middle region : Biotin

PLDN Antibody - middle region : Biotin
SKU
AVIARP54890_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLDN

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 6

Protein Size: 172

Purification: Affinity Purified
More Information
SKU AVIARP54890_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54890_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26258
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×