PLEK Antibody - N-terminal region : HRP

PLEK Antibody - N-terminal region : HRP
SKU
AVIARP56397_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEK

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin

Protein Size: 350

Purification: Affinity Purified
More Information
SKU AVIARP56397_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56397_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5341
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×