PLEKHA1 Antibody - N-terminal region : FITC

PLEKHA1 Antibody - N-terminal region : FITC
SKU
AVIARP57544_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA1

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology domain-containing family A member 1

Protein Size: 404

Purification: Affinity Purified
More Information
SKU AVIARP57544_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57544_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 59338
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×