PLEKHA9 Antibody - middle region : HRP

PLEKHA9 Antibody - middle region : HRP
SKU
AVIARP56768_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLEKHA9

Key Reference: Ishibashi,T., (2005) J. Biochem. 137 (5), 617-623

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative protein PLEKHA9

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP56768_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56768_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51054
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×