PLS1 Antibody - N-terminal region : FITC

PLS1 Antibody - N-terminal region : FITC
SKU
AVIARP56400_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this ge

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLS1

Key Reference: Chafel,M.M., (1995) Dev. Dyn. 203 (2), 141-151

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plastin-1

Protein Size: 629

Purification: Affinity Purified
More Information
SKU AVIARP56400_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56400_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5357
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×