PLS3 Antibody - middle region : FITC

PLS3 Antibody - middle region : FITC
SKU
AVIARP56623_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLS3

Key Reference: Oprea,G.E., (2008) Science 320 (5875), 524-527

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plastin-3

Protein Size: 630

Purification: Affinity Purified
More Information
SKU AVIARP56623_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56623_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5358
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×