PLSCR3 Antibody - middle region : HRP

PLSCR3 Antibody - middle region : HRP
SKU
AVIARP57395_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLSCR3

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phospholipid scramblase 3

Protein Size: 295

Purification: Affinity Purified
More Information
SKU AVIARP57395_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57395_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57048
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×