PNMA3 Antibody - middle region : FITC

PNMA3 Antibody - middle region : FITC
SKU
AVIARP54946_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMA3

Key Reference: Wills,N.M., (2006) J. Biol. Chem. 281 (11), 7082-7088

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paraneoplastic antigen Ma3

Protein Size: 463

Purification: Affinity Purified
More Information
SKU AVIARP54946_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54946_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29944
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×