PNMA8A Antibody - middle region : Biotin

PNMA8A Antibody - middle region : Biotin
SKU
AVIARP57154_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMAL1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: paraneoplastic antigen-like protein 8A

Protein Size: 439

Purification: Affinity Purified
More Information
SKU AVIARP57154_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57154_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55228
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×