PNOC Antibody - middle region : HRP

PNOC Antibody - middle region : HRP
SKU
AVIARP56692_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNOC

Key Reference: Williams,J.P., (2008) Anesth. Analg. 106 (3), 865-866

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prepronociceptin

Protein Size: 176

Purification: Affinity Purified
More Information
SKU AVIARP56692_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56692_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5368
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×