PNPLA8 Antibody - middle region : FITC

PNPLA8 Antibody - middle region : FITC
SKU
AVIARP56759_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNPLA8

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-independent phospholipase A2-gamma

Protein Size: 782

Purification: Affinity Purified
More Information
SKU AVIARP56759_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56759_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50640
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×