POLB Antibody - middle region : FITC

POLB Antibody - middle region : FITC
SKU
AVIARP56406_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLB

Key Reference: Batra,V.K., (2008) Mol. Cell 30 (3), 315-324

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase beta

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP56406_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56406_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5423
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×