POLB Antibody - middle region : HRP

POLB Antibody - middle region : HRP
SKU
AVIARP56406_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLB

Key Reference: Batra,V.K., (2008) Mol. Cell 30 (3), 315-324

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA polymerase beta

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP56406_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56406_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5423
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×