POLL Antibody - middle region : Biotin

POLL Antibody - middle region : Biotin
SKU
AVIARP54924_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLL

Key Reference: Picher,A.J. (2007) DNA Repair (Amst.) 6 (12), 1749-1756

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase lambda

Protein Size: 575

Purification: Affinity Purified
More Information
SKU AVIARP54924_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54924_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27343
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×