POLL Antibody - middle region : HRP

POLL Antibody - middle region : HRP
SKU
AVIARP54924_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLL

Key Reference: Picher,A.J. (2007) DNA Repair (Amst.) 6 (12), 1749-1756

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA polymerase lambda

Protein Size: 575

Purification: Affinity Purified
More Information
SKU AVIARP54924_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54924_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27343
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×