POP5 Antibody - middle region : FITC

POP5 Antibody - middle region : FITC
SKU
AVIARP56773_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POP5 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.POP5 is also a component of RNase MRP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POP5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribonuclease P/MRP protein subunit POP5

Protein Size: 163

Purification: Affinity Purified

Subunit: POP5
More Information
SKU AVIARP56773_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56773_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51367
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×