Pou3f3 Antibody - C-terminal region : HRP

Pou3f3 Antibody - C-terminal region : HRP
SKU
AVIARP57888_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: POU domain, class 3, transcription factor 3

Protein Size: 497

Purification: Affinity Purified
More Information
SKU AVIARP57888_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57888_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 192109
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×