PPM1A Antibody - middle region : Biotin

PPM1A Antibody - middle region : Biotin
SKU
AVIARP57765_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the acti

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPM1A

Key Reference: Wu,S.K., (2007) World J. Gastroenterol. 13 (34), 4554-4559

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1A

Protein Size: 324

Purification: Affinity Purified
More Information
SKU AVIARP57765_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57765_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5494
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×