PPM1B Antibody - N-terminal region : Biotin

PPM1B Antibody - N-terminal region : Biotin
SKU
AVIARP57767_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1B

Key Reference: Xiao,K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (29), 12011-12016

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1B

Protein Size: 192

Purification: Affinity Purified
More Information
SKU AVIARP57767_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57767_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5495
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×