PPM1J Antibody - N-terminal region : HRP

PPM1J Antibody - N-terminal region : HRP
SKU
AVIARP54744_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known. This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1J

Key Reference: Komaki,K., Biochim. Biophys. Acta 1630 (2-3), 130-137 (2003)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1J

Protein Size: 505

Purification: Affinity Purified
More Information
SKU AVIARP54744_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54744_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 333926
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×