PPME1 Antibody - N-terminal region : Biotin

PPME1 Antibody - N-terminal region : Biotin
SKU
AVIARP56844_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPME1

Key Reference: Longin,S., (2008) Exp. Cell Res. 314 (1), 68-81

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase methylesterase 1

Protein Size: 386

Purification: Affinity Purified
More Information
SKU AVIARP56844_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56844_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51400
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×