PPP2R1A Antibody - N-terminal region : HRP

PPP2R1A Antibody - N-terminal region : HRP
SKU
AVIARP57780_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform EMBL EAW72066.1

Protein Size: 589

Purification: Affinity Purified
More Information
SKU AVIARP57780_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57780_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5518
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×