Ppp2r2c Antibody - N-terminal region : Biotin

Ppp2r2c Antibody - N-terminal region : Biotin
SKU
AVIARP57784_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B gamma isoform
More Information
SKU AVIARP57784_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57784_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 269643
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×