PPP2R3A Antibody - N-terminal region : Biotin

PPP2R3A Antibody - N-terminal region : Biotin
SKU
AVIARP56410_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subu

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A

Key Reference: Ahn,J.H., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (23), 9876-9881

Molecular Weight: 130kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha

Protein Size: 1150

Purification: Affinity Purified

Subunit: B
More Information
SKU AVIARP56410_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56410_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5523
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×