Ppp2r3c Antibody - N-terminal region : Biotin

Ppp2r3c Antibody - N-terminal region : Biotin
SKU
AVIARP57063_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Protein Size: 453

Purification: Affinity Purified

Subunit: B''
More Information
SKU AVIARP57063_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57063_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 362739
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×