Ppp2r3c Antibody - N-terminal region : HRP

Ppp2r3c Antibody - N-terminal region : HRP
SKU
AVIARP57063_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Protein Size: 453

Purification: Affinity Purified

Subunit: B''
More Information
SKU AVIARP57063_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57063_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 362739
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×