PPP2R5C Antibody - middle region : Biotin

PPP2R5C Antibody - middle region : Biotin
SKU
AVIARP57771_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5C

Key Reference: Shouse,G.P., (2008) Mol. Cell. Biol. 28 (1), 448-456

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 2, regulatory subunit B', gamma isoform EMBL AAH16183.1

Protein Size: 384

Purification: Affinity Purified

Subunit: gamma isoform
More Information
SKU AVIARP57771_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57771_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5527
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×