PPP5C Antibody - N-terminal region : FITC

PPP5C Antibody - N-terminal region : FITC
SKU
AVIARP56695_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP5C

Key Reference: Golden,T., (2008) Biochim. Biophys. Acta 1782 (4), 259-270

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 5

Protein Size: 499

Purification: Affinity Purified
More Information
SKU AVIARP56695_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56695_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5536
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×