PPWD1 Antibody - middle region : FITC

PPWD1 Antibody - middle region : FITC
SKU
AVIARP55238_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPWD1

Key Reference: Jurica,M.S., (2002) RNA 8 (4), 426-439

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidylprolyl isomerase domain and WD repeat-containing protein 1

Protein Size: 646

Purification: Affinity Purified
More Information
SKU AVIARP55238_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55238_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23398
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×