PPWD1 Antibody - middle region : HRP

PPWD1 Antibody - middle region : HRP
SKU
AVIARP55238_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPWD1

Key Reference: Jurica,M.S., (2002) RNA 8 (4), 426-439

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptidylprolyl isomerase domain and WD repeat-containing protein 1

Protein Size: 646

Purification: Affinity Purified
More Information
SKU AVIARP55238_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55238_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23398
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×