PRAMEF10 Antibody - middle region : FITC

PRAMEF10 Antibody - middle region : FITC
SKU
AVIARP54493_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRAMEF10

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PRAME family member 10

Protein Size: 474

Purification: Affinity Purified
More Information
SKU AVIARP54493_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54493_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 343071
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×