PRDX5 Antibody - middle region : Biotin

PRDX5 Antibody - middle region : Biotin
SKU
AVIARP54831_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PRDX5

Key Reference: N/A

Molecular Weight: 17 kDa

Peptide Sequence: Synthetic peptide located within the following region: VACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxiredoxin-5, mitochondrial

Protein Size: 162

Purification: Affinity purified
More Information
SKU AVIARP54831_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54831_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25824
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×