PRELID2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRELID2

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PRELI domain-containing protein 2

Protein Size: 189

Purification: Affinity Purified

• SKU: AVIARP53440_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53440_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 153768
• Host: Rabbit
• Conjugate: Conjugated, FITC