PREP Antibody - N-terminal region : FITC

PREP Antibody - N-terminal region : FITC
SKU
AVIARP56413_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PREP

Key Reference: Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolyl endopeptidase

Protein Size: 710

Purification: Affinity Purified
More Information
SKU AVIARP56413_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56413_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5550
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×