Skip to the beginning of the images gallery

PrEST Antigen COL1A2

Name: PrEST Antigen COL1A2
Brand: Atlas Antibodies
SKU: ATLAPrEST96171-100

collagen type I alpha 2 chain

SKU

ATLAPrEST96171-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: COL1A2

Sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV

Interspecies Mouse/Rat: ENSMUSG00000029661: 92%, ENSRNOG00000011292: 92%

Entrez Gene ID: 1278

UniProt ID: P08123

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000164692

More Information
SKU	ATLAPrEST96171-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96171-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	1278
Product information (PDF)	Download
MSDS (PDF)	Download