Skip to the beginning of the images gallery

PrEST Antigen IL11RA

Name: PrEST Antigen IL11RA
Brand: Atlas Antibodies
SKU: ATLAPrEST96192-100

interleukin 11 receptor subunit alpha

SKU

ATLAPrEST96192-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: IL11RA

Sequence: RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP

Interspecies Mouse/Rat: ENSMUSG00000095623: 90%, ENSRNOG00000015068: 89%

Entrez Gene ID: 3590

UniProt ID: Q14626

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000137070

More Information
SKU	ATLAPrEST96192-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96192-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3590
Product information (PDF)	Download
MSDS (PDF)	Download