Skip to the beginning of the images gallery

PrEST Antigen KCNA7

Name: PrEST Antigen KCNA7
Brand: Atlas Antibodies
SKU: ATLAPrEST96195-100

potassium voltage-gated channel subfamily A member 7

SKU

ATLAPrEST96195-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: KCNA7

Sequence: TEGEEAGMFSHVDMQPCGPLEGKANGGLVDGEV

Interspecies Mouse/Rat: ENSRNOG00000020779: 88%, ENSMUSG00000038201: 88%

Entrez Gene ID: 3743

UniProt ID: Q96RP8

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000104848

More Information
SKU	ATLAPrEST96195-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96195-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3743
Product information (PDF)	Download
MSDS (PDF)	Download