Skip to the beginning of the images gallery

PrEST Antigen KCNN4

Name: PrEST Antigen KCNN4
Brand: Atlas Antibodies
SKU: ATLAPrEST96183-100

potassium calcium-activated channel subfamily N member 4

SKU

ATLAPrEST96183-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: KCNN4

Sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ

Interspecies Mouse/Rat: ENSMUSG00000054342: 85%, ENSRNOG00000019440: 82%

Entrez Gene ID: 3783

UniProt ID: O15554

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000104783

More Information
SKU	ATLAPrEST96183-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96183-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3783
Product information (PDF)	Download
MSDS (PDF)	Download