Skip to the beginning of the images gallery

PrEST Antigen KCNQ1

Name: PrEST Antigen KCNQ1
Brand: Atlas Antibodies
SKU: ATLAPrEST96197-100

potassium voltage-gated channel subfamily Q member 1

SKU

ATLAPrEST96197-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: KCNQ1

Sequence: YSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQ

Interspecies Mouse/Rat: ENSRNOG00000020532: 97%, ENSMUSG00000009545: 97%

Entrez Gene ID: 3784

UniProt ID: P51787

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000053918

More Information
SKU	ATLAPrEST96197-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96197-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3784
Product information (PDF)	Download
MSDS (PDF)	Download