Skip to the beginning of the images gallery

PrEST Antigen TEX264

Name: PrEST Antigen TEX264
Brand: Atlas Antibodies
SKU: ATLAPrEST96222-100

testis expressed 264, ER-phagy receptor

SKU

ATLAPrEST96222-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: TEX264

Sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL

Interspecies Mouse/Rat: ENSRNOG00000013201: 88%, ENSMUSG00000040813: 87%

Entrez Gene ID: 51368

UniProt ID: Q9Y6I9

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000164081

More Information
SKU	ATLAPrEST96222-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96222-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	51368
Product information (PDF)	Download
MSDS (PDF)	Download