Prkaa1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Prkaa1 is a catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism.

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-1

Protein Size: 548

Purification: Affinity Purified

Subunit: alpha-1

• SKU: AVIARP53651_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53651_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 105787
• Host: Rabbit
• Conjugate: Conjugated, FITC