PRKAR1B Antibody - middle region : HRP

PRKAR1B Antibody - middle region : HRP
SKU
AVIARP56420_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B

Key Reference: Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cAMP-dependent protein kinase type I-beta regulatory subunit

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP56420_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56420_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5575
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×